C14orf119 Rabbit Polyclonal Antibody

CAT#: TA344951

Rabbit Polyclonal Anti-C14orf119 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: C14orf119; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C14orf119 antibody is: synthetic peptide directed towards the N-terminal region of Human C14orf119. Synthetic peptide located within the following region: SSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: chromosome 14 open reading frame 119
• Database Link:
  NP_060394
  Entrez Gene 55017 Human
  UniProt ID Q9NWQ9
• Background: The function of this protein remains unknown.
• Synonyms: FLJ20671; FLJ21141; MGC74723
• Note: Immunogen Sequence Homology: Human: 100%