VG5Q (AGGF1) Rabbit Polyclonal Antibody

CAT#: TA344936

Rabbit Polyclonal Anti-AGGF1 Antibody - middle region

Product Images

WB Suggested Anti-AGGF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 293T cell lysateAGGF1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGGF1 antibody: synthetic peptide directed towards the middle region of human AGGF1. Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: angiogenic factor with G-patch and FHA domains 1
• Database Link:
  NP_060516
  Entrez Gene 55109 Human
  UniProt ID Q8N302
• Background: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain (Tian et al., 2004 [PubMed 14961121]).
• Synonyms: GPATC7; GPATCH7; HSU84971; HUS84971; VG5Q
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 92%

Reference Data

• Protein Families: Secreted Protein