TBCCD1 Rabbit Polyclonal Antibody

CAT#: TA344924

Rabbit Polyclonal Anti-TBCCD1 Antibody - N-terminal region

Product Images

WB Suggested Anti-TBCCD1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBCCD1 antibody: synthetic peptide directed towards the N terminal of human TBCCD1. Synthetic peptide located within the following region: WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: TBCC domain containing 1
• Database Link:
  NP_060608
  Entrez Gene 55171 Human
  UniProt ID Q9NVR7
• Background: The function of this protein remains unknown.
• Synonyms: FLJ10560
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 85%; Pig: 85%; Rabbit: 79%; Guinea pig: 79%; Bovine: 77%