TBC1D24 Rabbit Polyclonal Antibody

SKU TA344770

Rabbit Polyclonal Anti-TBC1D24 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBC1D24 antibody: synthetic peptide directed towards the middle region of human TBC1D24. Synthetic peptide located within the following region: SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: TBC1 domain family member 24
• Database Link:
  NP_065756
  Q9ULP9
• Background: TBC1D24 may act as a GTPase-activating protein for Rab family protein(s).
• Synonyms: DFNA65; DFNB86; DOORS; EIEE16; FIME; TLDC6
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%

Reference Data