Translation factor GUF1, mitochondrial (GUF1) Rabbit Polyclonal Antibody

CAT#: TA344716

Rabbit Polyclonal Anti-GUF1 Antibody - C-terminal region

Product Images

WB Suggested Anti-Guf1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Guf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: GUF1 homolog, GTPase
• Database Link:
  NP_068746
  Entrez Gene 231279 Mouse
  UniProt ID Q8N442
• Background: Guf1 promotes mitochondrial protein synthesis. It may act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. It binds to mitochondrial ribosomes in a GTP-dependent manner.
• Synonyms: EF-4; EF4; EIEE40
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Yeast: 90%; Zebrafish: 79%