VPS16 Rabbit Polyclonal Antibody

CAT#: TA344640

Rabbit Polyclonal Anti-VPS16 Antibody - N-terminal region

Product Images

WB Suggested Anti-VPS16 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VPS16 antibody: synthetic peptide directed towards the N terminal of human VPS16. Synthetic peptide located within the following region: RGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: VPS16, CORVET/HOPS core subunit
• Database Link:
  NP_536339
  Entrez Gene 64601 Human
  UniProt ID Q9H269
• Background: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CG8454; CG8454 gene product from transcript CG8454-RA; CG8454-PA; DmelCG8454; dVps16A; hVPS16; VPS16; Vps16A-PA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome