Tin2 (TINF2) Rabbit Polyclonal Antibody

CAT#: TA344375

Rabbit Polyclonal Anti-TINF2 Antibody - middle region

Product Images

WB Suggested Anti-TINF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysateTINF2 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: TINF2; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; TINF2 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TINF2 antibody: synthetic peptide directed towards the middle region of human TINF2. Synthetic peptide located within the following region: SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: TERF1 interacting nuclear factor 2
• Database Link:
  NP_001092744
  Entrez Gene 26277 Human
  UniProt ID Q9BSI4
• Background: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.
• Synonyms: DKCA3; TIN2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 92%; Guinea pig: 92%; Dog: 86%; Rat: 85%