CRPPA Rabbit Polyclonal Antibody

CAT#: TA344255

Rabbit Polyclonal Anti-hCG_1745121 Antibody - N-terminal region

Product Images

WB Suggested Anti-hCG_1745121 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-hCG_1745121 antibody: synthetic peptide directed towards the N terminal of human hCG_1745121. Synthetic peptide located within the following region: MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: isoprenoid synthase domain containing
• Database Link:
  NP_001094887
  Entrez Gene 729920 Human
  UniProt ID A4D126
• Background: The specific function of hCG_1745121 is not yet known.
• Synonyms: hCG_1745121; MDDGA7; MDDGC7; Nip
• Note: Immunogen Sequence Homology: Human: 100%