JAKMIP1 Rabbit Polyclonal Antibody

CAT#: TA343992

Rabbit Polyclonal Anti-JAKMIP1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of janus kinase and microtubule interacting protein 1 (JAKMIP1), transcript variant 2
    • 100 ug

USD 436.00

Other products for "JAKMIP1"

Specifications

Product Data
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-JAKMIP1 antibody: synthetic peptide directed towards the middle region of human JAKMIP1. Synthetic peptide located within the following region: FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 97 kDa
Gene Name janus kinase and microtubule interacting protein 1
Background JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.
Synonyms Gababrbp; JAMIP1; MARLIN1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 93%; Bovine: 92%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.