POU6F2 Rabbit Polyclonal Antibody

CAT#: TA343668

Rabbit Polyclonal Anti-POU6F2 Antibody

Product Images

WB Suggested Anti-POU6F2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the N terminal of human POU6F2. Synthetic peptide located within the following region: AATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: POU class 6 homeobox 2
• Database Link:
  NP_009183
  Entrez Gene 11281 Human
  UniProt ID P78424
• Background: POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways.POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-60 AC011292.3 84260-84319 61-553 U91935.1 102-594 554-927 AC005483.1 150160-150533 c 928-1068 AC005483.1 83435-83575 c 1069-1275 AC005483.1 56892-57098 c 1276-1613 U91935.1 1320-1657 1614-2223 AC005483.1 25384-25993 c
• Synonyms: RPF-1; WT5; WTSL
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors