Muted (BLOC1S5) Rabbit Polyclonal Antibody

CAT#: TA343285

Rabbit Polyclonal Anti-BLOC1S5 Antibody

Product Images

WB Suggested Anti-MUTED Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MUTED antibody is: synthetic peptide directed towards the C-terminal region of MUTED. Synthetic peptide located within the following region: LSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: biogenesis of lysosomal organelles complex 1 subunit 5
• Database Link:
  NP_958437
  Entrez Gene 63915 Human
  UniProt ID Q8TDH9
• Background: This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Alternative splicing results in multiple transcript variants. Read-through transcription exists between this gene and the upstream EEF1E1 (eukaryotic translation elongation factor 1 epsilon 1) gene, as well as with the downstream TXNDC5 (thioredoxin domain containing 5) gene.
• Synonyms: BLOS5; MU; MUTED
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%