Syntrophin (SNTB2) Rabbit Polyclonal Antibody

CAT#: TA343259

Rabbit Polyclonal Anti-SNTB2 Antibody

Product Images

Host: Rabbit; Target Name: SNTB2; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml SNTB2 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNTB2 antibody is: synthetic peptide directed towards the N-terminal region of Human SNTB2. Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: syntrophin beta 2
• Database Link:
  NP_006741
  Entrez Gene 6645 Human
  UniProt ID Q13425
• Background: Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.
• Synonyms: D16S2531E; EST25263; SNT2B2; SNT3; SNTL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%

Reference Data

• Protein Families: Secreted Protein