SEC13L1 (SEC13) Rabbit Polyclonal Antibody

CAT#: TA343258

Rabbit Polyclonal Anti-SEC13 Antibody

Product Images

Host: Rabbit; Target Name: SEC13; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC13 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC13. Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: SEC13 homolog, nuclear pore and COPII coat complex component
• Database Link:
  NP_899195
  Entrez Gene 6396 Human
  UniProt ID P55735
• Background: The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found.
• Synonyms: D3S1231E; npp-20; SEC13L1; SEC13R
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Pig: 85%; Guinea pig: 85%