TTLL1 Rabbit Polyclonal Antibody

CAT#: TA343215

Rabbit Polyclonal Anti-TTLL1 Antibody

Product Images

Host: Rabbit; Target Name: TTLL1; Sample Tissue: 721_B whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TTLL1 antibody is: synthetic peptide directed towards the C-terminal region of Human TTLL1. Synthetic peptide located within the following region: PNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: tubulin tyrosine ligase like 1
• Database Link:
  NP_036395
  Entrez Gene 25809 Human
  UniProt ID O95922
• Background: TTLL1 catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.
• Synonyms: C22orf7; HS323M22B
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Rat: 92%; Pig: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 85%; Mouse