PSCDBP (CYTIP) Rabbit Polyclonal Antibody

CAT#: TA343214

Rabbit Polyclonal Anti-CYTIP Antibody

Product Images

Host: Rabbit; Target Name: Cytip; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cytip antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cytip. Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: cytohesin 1 interacting protein
• Database Link:
  NP_004279
  Entrez Gene 227929 Mouse
  UniProt ID O60759
• Background: By its binding to cytohesin-1 (CYTH1), Cytip modifies activation of ARFs by CYTH1 and its precise function may be to sequester CYTH1 in the cytoplasm.
• Synonyms: B3-1; CASP; CYBR; CYTHIP; HE; PSCDBP
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Zebrafish: 86%