AKR1C1 Rabbit Polyclonal Antibody

CAT#: TA342866

Rabbit Polyclonal Anti-AKR1C1 Antibody

Product Images

WB Suggested Anti-AKR1C1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: aldo-keto reductase family 1, member C1
• Database Link:
  NP_001344
  Entrez Gene 1645 Human
  UniProt ID Q04828
• Background: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
• Synonyms: 2-ALPHA-HSD; 20-ALPHA-HSD; C9; DD1; DD2; DDH; DDH1; H-37; HAKRC; HBAB; MBAB
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Rat: 82%; Rabbit: 82%; Dog; Pig; Horse

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolism of xenobiotics by cytochrome P450