OSGIN2 Rabbit Polyclonal Antibody

CAT#: TA342836

Rabbit Polyclonal Anti-OSGIN2 Antibody

Product Images

WB Suggested Anti-OSGIN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OSGIN2 antibody: synthetic peptide directed towards the C terminal of human OSGIN2. Synthetic peptide located within the following region: ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: oxidative stress induced growth inhibitor family member 2
• Database Link:
  NP_004328
  Entrez Gene 734 Human
  UniProt ID Q9Y236
• Background: OSGIN2 may be involved in meiosis or the maturation of germ cells.
• Synonyms: C8orf1; hT41
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 87%; Bovine: 87%; Guinea pig: 80%