HHIPL1 Rabbit Polyclonal Antibody

CAT#: TA342757

Rabbit Polyclonal Anti-HHIPL1 Antibody

Product Images

WB Suggested Anti-HHIPL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MDA-MB-435S cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HHIPL1 antibody: synthetic peptide directed towards the C terminal of human HHIPL1. Synthetic peptide located within the following region: EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: HHIP like 1
• Database Link:
  NP_115801
  Entrez Gene 84439 Human
  UniProt ID Q96JK4
• Background: The function of this protein remains unknown.
• Synonyms: KIAA1822; UNQ9245
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 91%; Dog: 86%; Zebrafish: 86%; Guinea pig: 86%; Bovine: 85%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome