USP8 Rabbit Polyclonal Antibody

CAT#: TA342559

Rabbit Polyclonal Anti-USP8 Antibody

Product Images

WB Suggested Anti-USP8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HCT15 cell lysate USP8 is supported by BioGPS gene expression data to be expressed in HCT15

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 127 kDa
• Gene Name: ubiquitin specific peptidase 8
• Database Link:
  NP_005145
  Entrez Gene 9101 Human
  UniProt ID P40818
• Background: USP8 is a hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. USP8 catalytic activity is enhanced in the M phase. USP8 is involved in cell proliferation. USP8 is required to enter into S phase in response to serum stimulation. USP8 may regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. USP8 probably regulates the stability of STAM2 and RASGRF1. USP8 regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle.USP8 deubiquitinates EPS15 and controles tyrosine kinase stability.USP8 removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. USP8 is involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules.
• Synonyms: HumORF8; SPG59; UBPY
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 85%; Pig: 85%; Bovine: 85%; Rat

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Endocytosis