SEPN1 (SELENON) Rabbit Polyclonal Antibody

CAT#: TA342465

Rabbit Polyclonal Anti-Sepn1 Antibody

Product Images

WB Suggested Anti-Sepn1 Antibody Titration: 1 ug/ml; Positive Control: Mouse Heart lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sepn1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: selenoprotein N, 1
• Database Link:
  NP_996809
  Entrez Gene 74777 Mouse
  UniProt ID Q9NZV5
• Background: This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. The function of this gene in mouse is not known, however, mutations in the homologous gene in human are associated with multiminicore disease and rigid spine muscular dystrophy. [provided by RefSeq, Jul 2008]
• Synonyms: CFTD; MDRS1; RSMD1; RSS; SELN
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome