C9orf152 Rabbit Polyclonal Antibody

CAT#: TA342405

Rabbit Polyclonal Anti-C9orf152 Antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of chromosome 9 open reading frame 152 (C9orf152)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human chromosome 9 open reading frame 152 (C9orf152), 20 µg
    • 20 ug

USD 867.00

Other products for "C9orf152"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C9orf152 antibody: synthetic peptide directed towards the N terminal of human C9orf152. Synthetic peptide located within the following region: MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 24 kDa
Gene Name chromosome 9 open reading frame 152
Background The function of this protein remains unknown.
Synonyms bA470J20.2
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Mouse: 92%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.