DUXA Rabbit Polyclonal Antibody

CAT#: TA342404

Rabbit Polyclonal Anti-DUXA Antibody

Product Images

WB Suggested Anti-DUXA Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DUXA antibody: synthetic peptide directed towards the middle region of human DUXA. Synthetic peptide located within the following region: SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGART
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: double homeobox A
• Database Link:
  NP_001012747
  Entrez Gene 503835 Human
  UniProt ID A6NLW8
• Background: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DUXA homeobox gene family. Evidence of mRNA expression has not yet been found for this gene. Multiple, related processed pseudogenes have been found which are thought to reflect expression of this gene in the germ line or embryonic cells. [provided by RefSeq, Jul 2008]
• Synonyms: DUXA
• Note: Immunogen Sequence Homology: Human: 100%