OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NRIP2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342347
Rabbit Polyclonal Anti-NRIP2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "NRIP2 or NM_031474" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NRIP2 antibody: synthetic peptide directed towards the N terminal of mouse NRIP2. Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 25 kDa
Gene Name nuclear receptor interacting protein 2
Database Link
Background NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors.
Synonyms DKFZp761G1913
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Zebrafish: 85%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products