TCEA1 Rabbit Polyclonal Antibody

CAT#: TA342294

Rabbit Polyclonal Anti-TCEA1 Antibody

Product Images

WB Suggested Anti-TCEA1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEA1 antibody: synthetic peptide directed towards the middle region of mouse TCEA1. Synthetic peptide located within the following region: NVSSRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYVAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: transcription elongation factor A1
• Database Link:
  NP_958845
  Entrez Gene 21399 Mouse
  UniProt ID P23193
• Background: Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
• Synonyms: GTF2S; SII; TCEA; TF2S; TFIIS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors