NFAT1 (NFATC2) Rabbit Polyclonal Antibody

CAT#: TA342283

Rabbit Polyclonal Anti-NFATC2 Antibody

Product Images

WB Suggested Anti-NFATC2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the N terminal of mouse NFATC2. Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: nuclear factor of activated T-cells 2
• Database Link:
  NP_036472
  Entrez Gene 18019 Mouse
  UniProt ID Q13469
• Background: Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. Promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway.
• Synonyms: NFAT1; NFATP
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Horse: 93%; Human: 93%; Bovine: 86%; Dog: 82%; Pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Axon guidance, B cell receptor signaling pathway, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway