NDUFS1 Rabbit Polyclonal Antibody

CAT#: TA342229

Rabbit polyclonal Anti-Ndufs1 Antibody

Product Images

Host: Rabbit; Target Name: Ndufs1; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ndufs1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ndufs1. Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: NADH:ubiquinone oxidoreductase core subunit S1
• Database Link:
  NP_004997
  Entrez Gene 301458 Rat
  UniProt ID P28331
• Background: Core subunit ofThe mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong toThe minimal assembly required for catalysis. Complex I functions inThe transfer of electrons from NADH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone (By similarity).This isThe largest subunit of complex I and it is a component ofThe iron-sulfur (IP) fragment ofThe enzyme. It may form part ofThe active site crevice where NADH is oxidized.
• Synonyms: CI-75k; CI-75Kd; PRO1304
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%; Goat: 86%; Zebrafish: 86%; Yeast: 85%

Reference Data

• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease