NDUFS1 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Ndufs1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ndufs1. Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 79 kDa |
Gene Name | NADH:ubiquinone oxidoreductase core subunit S1 |
Database Link | |
Background | Core subunit ofThe mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong toThe minimal assembly required for catalysis. Complex I functions inThe transfer of electrons from NADH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone (By similarity).This isThe largest subunit of complex I and it is a component ofThe iron-sulfur (IP) fragment ofThe enzyme. It may form part ofThe active site crevice where NADH is oxidized. |
Synonyms | CI-75k; CI-75Kd; PRO1304 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%; Goat: 86%; Zebrafish: 86%; Yeast: 85% |
Reference Data | |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review