MYO1E Rabbit Polyclonal Antibody

CAT#: TA342227

Rabbit polyclonal Anti-MYO1E Antibody

Product Images

WB Suggested Anti-MYO1E Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYO1E antibody: synthetic peptide directed towards the middle region of human MYO1E. Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 127 kDa
• Gene Name: myosin IE
• Database Link:
  NP_004989
  Entrez Gene 4643 Human
  UniProt ID Q12965
• Background: This gene encodes a member ofThe nonmuscle class I myosins which are a subgroup ofThe unconventional myosin protein family.The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. AmongThe class I myosins,This protein is distinguished by a long tail domain that is involved in crosslinking actin filaments.This protein localizes toThe cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations inThis gene areThe cause of focal segmental glomerulosclerosis-6.This gene has been referred to as myosin IC inThe literature but is distinct fromThe myosin IC gene located on chromosome 17. [provided by RefSeq, Jan 2012]
• Synonyms: FSGS6; HuncM-IC; MYO1C
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%