PRPSAP2 Rabbit Polyclonal Antibody

CAT#: TA342155

Rabbit polyclonal Anti-PRPSAP2 Antibody

Product Images

WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:100; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: PRPSAP2; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PRPSAP2; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; PRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: PRPSAP2; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; PRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: PRPSAP2; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; PRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: PRPSAP2; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa

• Host: Rabbit; Target Name: PRPSAP2; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 2.0 ug/ml; PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa

Show all 7 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRPSAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human PRPSAP2. Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: phosphoribosyl pyrophosphate synthetase associated protein 2
• Database Link:
  NP_002758
  Entrez Gene 5636 Human
  UniProt ID O60256
• Background: This gene encodes a protein that associates withThe enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzesThe formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits.This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Synonyms: PAP41
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome