PKC iota (PRKCI) Rabbit Polyclonal Antibody

CAT#: TA342150

Rabbit polyclonal Anti-PRKCI Antibody

Product Images

WB Suggested Anti-PRKCI Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRKCI antibody: synthetic peptide directed towards the middle region of human PRKCI. Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: protein kinase C iota
• Database Link:
  NP_002731
  Entrez Gene 5584 Human
  UniProt ID P41743
• Background: This gene encodes a member ofThe protein kinase C (PKC) family of serine/threonine protein kinases.The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes.This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol.This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction withThe small GTPase RAB2, whereThis kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics inThe early secretory pathway.This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis andTherefore protects leukemia cells against drug-induced apoptosis.There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008]
• Synonyms: DXS1179E; nPKC-iota; PKCI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Endocytosis, Insulin signaling pathway, Tight junction