PDE2A Rabbit Polyclonal Antibody

CAT#: TA342145

Rabbit polyclonal Anti-Pde2a Antibody

Product Images

WB Suggested Anti-Pde2a Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pde2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 104 kDa
• Gene Name: phosphodiesterase 2A
• Database Link:
  NP_002590
  Entrez Gene 81743 Rat
  UniProt ID O00408
• Background: activation induces decreased cAMP accumulation; involved in nitric oxide mediated signaling in cardiac fibroblasts [RGD, Feb 2006]. Transcript Variant:This variant (1) representsThe longest transcript and encodesThe longest isoform (PDE2A3).This variant is assembled from partial rat transcripts.The full-length exon combination is based onThe mouse ortholog, NM_001008548.4. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS160522, ERS160537 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: CGS-PDE; cGSPDE; PDE2A1; PED2A4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Progesterone-mediated oocyte maturation, Purine metabolism