BRI3BP Rabbit Polyclonal Antibody

CAT#: TA342090

Rabbit Polyclonal Anti-BRI3BP Antibody

Product Images

WB Suggested Anti-BRI3BP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRI3BP antibody: synthetic peptide directed towards the C terminal of human BRI3BP. Synthetic peptide located within the following region: GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: BRI3 binding protein
• Database Link:
  NP_542193
  Entrez Gene 140707 Human
  UniProt ID Q8WY22
• Background: BRI3BP is involved inThe structural dynamics ofThe ER and affects mitochondrial viability.It is widely expressed in animal cell types, that seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.The protein is highly expressed in brain, kidney, and liver, and it mapped to human chromosome 12q24.2-qter.Small nucleolar RNAs (snoRNAs) are small noncoding RNAs involved in RNA processing. Box H/ACA snoRNAs, such as SNORA45, directThe conversion of uridine to pseudouridine at specific residues of ribosomal RNAs or small nuclear RNAs (snRNAs) (Gu et al., 2005). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-131 AM055744.1 1-131
• Synonyms: BNAS1; HCCR-1; HCCR-2; HCCRBP-1; HCCRBP-3; KG19
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Rat: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane