TMEM132B Rabbit Polyclonal Antibody

CAT#: TA342069

Rabbit Polyclonal Anti-TMEM132B Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of transmembrane protein 132B (TMEM132B)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "TMEM132B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM132B antibody: synthetic peptide directed towards the middle region of human TMEM132B. Synthetic peptide located within the following region: VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 119 kDa
Gene Name transmembrane protein 132B
Background TMEM132B single-pass type I membrane protein. It belongs toThe TMEM132 family.The exact function of TMEM132B is not known.
Synonyms KIAA1786; KIAA1906
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Bovine: 86%; Mouse: 79%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.