Syndecan 3 (SDC3) Rabbit Polyclonal Antibody

CAT#: TA341948

Rabbit Polyclonal Anti-Sdc3 Antibody

Product Images

WB Suggested Anti-Sdc3 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sdc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: syndecan 3
• Database Link:
  NP_055469
  Entrez Gene 20970 Mouse
  UniProt ID O75056
• Background: Cell surface proteoglycan that may bear heparan sulfate. May have a role inThe organization of cell shape by affectingThe actin cytoskeleton, possibly by transferring signals fromThe cell surface in a sugar-dependent mechanism.
• Synonyms: SDCN; SYND3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), ECM-receptor interaction