TRAM2 Rabbit Polyclonal Antibody

CAT#: TA341903

Rabbit Polyclonal Anti-TRAM2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of translocation associated membrane protein 2 (TRAM2)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "TRAM2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRAM2 antibody: synthetic peptide directed towards the N terminal of human TRAM2. Synthetic peptide located within the following region: MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 43 kDa
Gene Name translocation associated membrane protein 2
Background TRAM2 is a component ofThe translocon, a gated macromolecular channel that controlsThe posttranslational processing of nascent secretory and membrane proteins atThe endoplasmic reticulum (ER) membrane. [supplied by OMIM, Jul 2004]. ##Evidence-Data-START## Transcript exon combination :: BC028121.1, D31762.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms KIAA0057
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Pig: 92%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.