TRAM2 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of translocation associated membrane protein 2 (TRAM2)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "TRAM2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRAM2 antibody: synthetic peptide directed towards the N terminal of human TRAM2. Synthetic peptide located within the following region: MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 43 kDa |
Gene Name | translocation associated membrane protein 2 |
Database Link | |
Background | TRAM2 is a component ofThe translocon, a gated macromolecular channel that controlsThe posttranslational processing of nascent secretory and membrane proteins atThe endoplasmic reticulum (ER) membrane. [supplied by OMIM, Jul 2004]. ##Evidence-Data-START## Transcript exon combination :: BC028121.1, D31762.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end. |
Synonyms | KIAA0057 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Pig: 92%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.