BVES Rabbit Polyclonal Antibody

CAT#: TA341880

Rabbit Polyclonal Anti-BVES Antibody

Product Images

WB Suggested Anti-BVES Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BVES antibody: synthetic peptide directed towards the middle region of human BVES. Synthetic peptide located within the following region: YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: blood vessel epicardial substance
• Database Link:
  NP_009004
  Entrez Gene 11149 Human
  UniProt ID Q8NE79
• Background: This gene encodes a member ofThe POP family of proteins containing three putative transmembrane domains.This gene is expressed in cardiac and skeletal muscle and may play an important role in development ofThese tissues.The mouse ortholog may be involved inThe regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Three transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Dec 2010]
• Synonyms: HBVES; LGMD2X; POP1; POPDC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%; Yeast: 82%

Reference Data

• Protein Families: Transmembrane