VAMP5 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 13 kDa |
Gene Name | vesicle associated membrane protein 5 |
Database Link | |
Background | Synaptobrevins/VAMPs, syntaxins, andThe 25-kD synaptosomal-associated protein areThe main components of a protein complex involved inThe docking and/or fusion of vesicles and cell membranes.The VAMP5 gene is a member ofThe vesicle-associated membrane protein (VAMP)/synaptobrevin family andThe SNARE superfamily.This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008] |
Synonyms | MYOBREVIN; myobrevin; vesicle-associated membrane protein 5; vesicle-associated membrane protein 5 (myobrevin) |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review