TRIM41 Rabbit Polyclonal Antibody

CAT#: TA341708

Rabbit Polyclonal Anti-KL Antibody

Product Images

WB Suggested Anti-KL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KL antibody: synthetic peptide directed towards the n terminal of human KL. Synthetic peptide located within the following region: FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: tripartite motif containing 41
• Database Link:
  NP_291027
  Entrez Gene 90933 Human
  UniProt ID Q8WV44
• Background: This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production ofThis protein has been observed in patients with chronic renal failure (CRF), andThis may be one ofThe factors underlyingThe degenerative processes (e.g., arteriosclerosis, osteoporosis, and skin atrophy) seen in CRF. Also, mutations withinThis protein have been associated with ageing and bone loss. [provided by RefSeq, Jul 2008]
• Synonyms: RINCK
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome