PGBD3 Rabbit Polyclonal Antibody

CAT#: TA341631

Rabbit Polyclonal Anti-PGBD3 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of piggyBac transposable element derived 3 (PGBD3)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human piggyBac transposable element derived 3 (PGBD3), 20 µg
    • 20 ug

USD 867.00

Other products for "PGBD3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PGBD3 antibody: synthetic peptide directed towards the N terminal of human PGBD3. Synthetic peptide located within the following region: AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 67 kDa
Gene Name piggyBac transposable element derived 3
Background This gene is a member of a small family of genes derived from piggyBac transposable elements.The encoded protein contains a zinc-ribbon domain characteristic of transposon-derived proteins and may function as a regulator of transcription. Naturally-occurring readthrough transcription occurs betweenThis gene andThe adjacent ERCC6 gene (GeneID 2074), and results in a fusion protein that shares sequence withThe product of each individual gene.The readthrough locus is represented by GeneID:101243544.There are several pseudogenes forThis gene on chromosomes 4, 5 and 12. [provided by RefSeq, Mar 2013]
Synonyms FLJ90201
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.