CHD1L Rabbit Polyclonal Antibody

CAT#: TA341563

Rabbit Polyclonal Anti-CHD1L Antibody

Product Images

WB Suggested Anti-CHD1L Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateCHD1L is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHD1L antibody: synthetic peptide directed towards the middle region of human CHD1L. Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: chromodomain helicase DNA binding protein 1 like
• Database Link:
  NP_001243265
  Entrez Gene 9557 Human
  UniProt ID Q86WJ1
• Background: This gene encodes a DNA helicase protein involved in DNA repair.The protein converts ATP to add poly(ADP-ribose) as it regulates chromatin relaxation following DNA damage. Several alternatively spliced transcripts variants have been described forThis gene. [provided by RefSeq, Jan 2012]
• Synonyms: ALC1; CHDL
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 86%