TPRX1 Rabbit Polyclonal Antibody

CAT#: TA341545

Rabbit Polyclonal Anti-TPRX1 Antibody

Product Images

WB Suggested Anti-TPRX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TPRX1 antibody: synthetic peptide directed towards the middle region of human TPRX1. Synthetic peptide located within the following region: LDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: tetra-peptide repeat homeobox 1
• Database Link:
  NP_940881
  Entrez Gene 284355 Human
  UniProt ID Q8N7U7
• Background: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to asThe homeodomain.This gene is a member ofThe TPRX homeobox gene family. [provided by RefSeq, Jul 2008]
• Synonyms: TPRX
• Note: Immunogen Sequence Homology: Human: 100%