ESX1 Rabbit Polyclonal Antibody

CAT#: TA341509

Rabbit Polyclonal Anti-ESX1 Antibody

Product Images

WB Suggested Anti-ESX1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of human ESX1. Synthetic peptide located within the following region: SLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDREGGGGHEPEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ESX homeobox 1
• Database Link:
  NP_703149
  Entrez Gene 80712 Human
  UniProt ID Q8N693
• Background: This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain.The C-terminal fragment localizes toThe cytoplasm whileThe N-terminal fragment localizes exclusively toThe nucleus. In contrast to human,The mouse homolog has a novel PN/PF motif inThe C-terminus and is paternally imprinted in placental tissue.This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010]
• Synonyms: ESX1L; ESXR1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors