ESX1 Rabbit Polyclonal Antibody

CAT#: TA341509

Rabbit Polyclonal Anti-ESX1 Antibody

 Product Datasheet for 'TA341509'

USD 300.00

5 Days

    • 100 ul

Product images


Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of human ESX1. Synthetic peptide located within the following region: SLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDREGGGGHEPEQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1mg/ml
Predicted Protein Size 44kDa
Gene Name ESX homeobox 1
Background This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain.The C-terminal fragment localizes toThe cytoplasm whileThe N-terminal fragment localizes exclusively toThe nucleus. In contrast to human,The mouse homolog has a novel PN/PF motif inThe C-terminus and is paternally imprinted in placental tissue.This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010].
Synonyms ESX1L|ESXR1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Other products for "ESX1"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones