Lass5 (CERS5) Rabbit Polyclonal Antibody

CAT#: TA341466

Rabbit Polyclonal Anti-LASS5 Antibody

Product Images

WB Suggested Anti-LASS5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LASS5 antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: ceramide synthase 5
• Database Link:
  NP_671723
  Entrez Gene 91012 Human
  UniProt ID Q8N5B7
• Background: This gene encodes a protein that belongs toThe TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins.The encoded protein functions inThe synthesis of ceramide, a lipid molecule that is involved in a several cellular signaling pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Synonyms: LASS5; Trh4
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors, Transmembrane