ZNF557 Rabbit Polyclonal Antibody

CAT#: TA341390

Rabbit Polyclonal Anti-ZNF557 Antibody

Product Images

WB Suggested Anti-ZNF557 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF557 antibody: synthetic peptide directed towards the middle region of human ZNF557. Synthetic peptide located within the following region: GKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: zinc finger protein 557
• Database Link:
  NP_077317
  Entrez Gene 79230 Human
  UniProt ID Q8N988
• Background: May be involved in transcriptional regulation.
• Synonyms: FLJ96454; MGC4054
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 77%; Pig: 77%; Rat: 77%; Horse: 77%; Mouse: 77%; Bovine: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors