CSNK1A1L Rabbit Polyclonal Antibody

CAT#: TA340392

Rabbit Polyclonal Anti-CSNK1A1L Antibody

Product Images

WB Suggested Anti-CSNK1A1L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: casein kinase 1 alpha 1 like
• Database Link:
  NP_660204
  Entrez Gene 122011 Human
  UniProt ID Q8N752
• Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. CSNK1A1L participates in Wnt signaling.
• Synonyms: CK1
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 79%; Dog: 77%; Pig: 77%; Rat: 77%; Horse: 77%; Mouse: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Hedgehog signaling pathway, Wnt signaling pathway