C7orf31 Rabbit Polyclonal Antibody

CAT#: TA340318

Rabbit Polyclonal Anti-C7orf31 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of chromosome 7 open reading frame 31 (C7orf31)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "C7orf31"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C7orf31 antibody: synthetic peptide directed towards the N terminal of human C7orf31. Synthetic peptide located within the following region: EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 68 kDa
Gene Name chromosome 7 open reading frame 31
Background The exact function of C7orf31 remains unknown.
Synonyms OTTHUMP00000202039
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.