Neurexophilin 3 (NXPH3) Rabbit Polyclonal Antibody

CAT#: TA340163

Rabbit Polyclonal Anti-NXPH3 Antibody

Product Images

WB Suggested Anti-NXPH3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: A549 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NXPH3 antibody: synthetic peptide directed towards the N terminal of human NXPH3. Synthetic peptide located within the following region: RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: neurexophilin 3
• Database Link:
  NP_009156
  Entrez Gene 11248 Human
  UniProt ID O95157
• Background: NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.
• Synonyms: NPH3
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Secreted Protein