SEC23IP Rabbit Polyclonal Antibody

CAT#: TA340158

Rabbit Polyclonal Anti-SEC23IP Antibody

Product Images

WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysateSEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC23IP antibody: synthetic peptide directed towards the N terminal of human SEC23IP. Synthetic peptide located within the following region: VPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 111 kDa
• Gene Name: SEC23 interacting protein
• Database Link:
  NP_009121
  Entrez Gene 11196 Human
  UniProt ID Q9Y6Y8
• Background: COPII-coated vesicles are involved in protein transport from the endoplasmic reticulum to the Golgi apparatus. The protein encoded by this gene was identified by its interaction with a mouse protein similar to yeast Sec23p, an essential component of the COPII. This protein shares significant similarity with phospholipid-modifying proteins, especially phosphatidic acid preferring-phospholipase A1. Overexpression of this protein has been shown to cause disorganization of the endoplasmic reticulum-Golgi intermediate compartment and Golgi apparatus, which suggests its role in the early secretory pathway.
• Synonyms: MSTP053; P125; P125A
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 86%