Sorbs1 Rabbit Polyclonal Antibody

CAT#: TA339964

Rabbit Polyclonal Anti-Sorbs1 Antibody

Product Images

WB Suggested Anti-Sorbs1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: sorbin and SH3 domain containing 1
• Database Link:
  NP_848139
  Entrez Gene 20411 Mouse
  UniProt ID Q62417
• Background: The function of this protein remains unknown.
• Synonyms: CAP; DKFZp451C066; DKFZp586P1422; FLAF2; FLJ12406; KIAA0894; KIAA1296; OTTHUMP00000020142; OTTHUMP00000020143; OTTHUMP00000020144; OTTHUMP00000020145; ponsin; R85FL; SH3D5; SH3P12; SORB1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%