LIN9 Rabbit Polyclonal Antibody

CAT#: TA339817

Rabbit Polyclonal Anti-LIN9 Antibody

Product Images

WB Suggested Anti-LIN9 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LIN9 antibody: synthetic peptide directed towards the N terminal of human LIN9. Synthetic peptide located within the following region: SLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: lin-9 DREAM MuvB core complex component
• Database Link:
  NP_775106
  Entrez Gene 286826 Human
  UniProt ID Q5TKA1
• Background: LIN9 belongs to the lin-9 family and acts as a tumor suppressor. It inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. LIN9 plays a role in the expression of genes required for the G1/S transition.
• Synonyms: BARA; BARPsv; Lin-9; TGS; TGS1; TGS2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome