ZNF678 Rabbit Polyclonal Antibody

CAT#: TA339789

Rabbit Polyclonal Anti-ZNF678 Antibody

Product Images

Host: Rabbit; Target Name: ZNF678; Sample Tissue: OVCAR-3 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF678 antibody is: synthetic peptide directed towards the middle region of Human ZNF678. Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: zinc finger protein 678
• Database Link:
  NP_848644
  Entrez Gene 339500 Human
• Background: ZNF678 may be involved in transcriptional regulation.
• Synonyms: FLJ18355; FLJ22822; MGC15634; MGC42493
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Bovine: 83%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%