ZNF678 Rabbit Polyclonal Antibody

CAT#: TA339789

Rabbit Polyclonal Anti-ZNF678 Antibody

 Product Datasheet for 'TA339789'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF678 antibody is: synthetic peptide directed towards the middle region of Human ZNF678. Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1mg/mL
Purification Affinity Purified
Predicted Protein Size 57kDa
Gene Name zinc finger protein 678
Background ZNF678 may be involved in transcriptional regulation.
Synonyms -
Note Immunogen Sequence Homology: Human: 100%; Dog: 85%; Bovine: 83%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Other products for "ZNF678"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies